PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM12G01870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 392aa    MW: 43454.6 Da    PI: 6.6421
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM12G01870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.35.3e-52111381128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+v+yL +++++ k+++  +i+ev+iyk++PwdLp k+  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk++ls
  OGLUM12G01870.1  11 LPPGFRFHPTDEELIVHYLMNQAASVKCPV-PIIAEVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSILS 103
                      79****************************.88***************8777899**************************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++ ++g+kk Lvfykg+ pkg+ktdW+mheyrl
  OGLUM12G01870.1 104 TpTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRL 138
                      988899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-647172IPR003441NAC domain
PROSITE profilePS5100559.09911172IPR003441NAC domain
PfamPF023652.8E-2612138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MPSSGGAMPA LPPGFRFHPT DEELIVHYLM NQAASVKCPV PIIAEVNIYK CNPWDLPGKA  60
LFGENEWYFF SPRDRKYPNG ARPNRAAGSG YWKATGTDKS ILSTPTSDNI GVKKALVFYK  120
GKPPKGVKTD WIMHEYRLTG TSANNTTTTK QRRASSMTMR LDDWVLCRIH KKSNDFNSSD  180
QHDQEPEGST VDEQLEDIHD NNSSSQQPPA PPDMNNQQSD FQPMTAMSMS KSCSLTDLLN  240
NLDCAALSQF LLDGSSDAIA ELPAPPSPLI YPNQTLNYNI NNNMPHALES RLDHHDGYVN  300
NYNVNGLRRK RMMACSATSF DDGSSSSSDF LHVAKKPLLL PSDSRGSGFG GGYCNQQLSE  360
TATGFQFQNG NMLSHPFPLN QQLLLNNHLQ MQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-731117815174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankBX0004950.0BX000495.1 Oryza sativa chromosome 12, . BAC OSJNBb0119L20 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankCP0126200.0CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620532.10.0PREDICTED: NAC transcription factor 29
TrEMBLA0A0E0BN900.0A0A0E0BN90_9ORYZ; Uncharacterized protein
STRINGLOC_Os12g03040.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38033775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.14e-81NAC domain containing protein 47